Preview

Down's Syndrome Research Paper

Good Essays
Open Document
Open Document
644 Words
Grammar
Grammar
Plagiarism
Plagiarism
Writing
Writing
Score
Score
Down's Syndrome Research Paper
Forming a family needs a lot, even more than what you have expected. But, among all these things, what is more important than anything else is a healthy baby free from the possibility of genetic disorders and genetic diseases that may result in big problems and even in chronic health complications. A simple blood test can detect genetic diseases early in pregnancy and help you in ensuring good health of your kid.
There is no denying the fact that single-gene disorders are more common than Down's Syndrome that need proper treatment and care. There is a safe prenatal test to help prospective parents decide what to do.
This is a wonderful test for genetic disorders that help women to learn about the future health of their baby as early as one
…show more content…

According to them, there are more than 10000 single-gene conditions that can affect births. In that case, options for parents are very limited. However, pre-implantation genetic diagnosis can be used for the screening of embryos - mainly when couples are opting for IVF. For those who are planning pregnancy in natural way, amniocentesis test is important. It is important to note; such tests can carry small risk of miscarriage - but detect different genetic disorders.
However, another important part is that improvement can be seen in the speed and ease of safer test. Not to mention non-invasive prenatal test for Down's syndrome that is done to detect single-gene diseases. This test is ideal to detect any single-gene disorder in the first 6 to 10 weeks of pregnancy. Such tests are done on the basis of DNA that looks for increases in the mutation level with a particular condition in the mother's blood once she is pregnant.
Recombine's CarrierMap Screening - A Revolutionary Test to Help Parents in Forming a Family with Healthy


You May Also Find These Documents Helpful

  • Good Essays

    Genetic testing is offered to families who believe they may have the defective gene that causes MSUD for future pregnancies. This DNA testing isn’t necessary to diagnose the child. A prenatal diagnosis involves testing the amniotic fluid surrounding the baby in the womb. They test for enzyme activity in cultured aminocytes or chorion villus cells that are rich in stem cells or mutation analysis. Newborns are screened by a blood sample taken from the heel and analyzed for high leucine levels. A urine amino acid test will reveal signs of ketosis, a high level of ketone bodies and acidosis, an excess amount of acid in the…

    • 982 Words
    • 4 Pages
    Good Essays
  • Good Essays

    Tay Sachs Research Paper

    • 1245 Words
    • 5 Pages

    Genetic testing can also be performed on parents before they conceive a child to determine whether they are carriers of the disease. This would be especially important if both parents were from high-risk populations to prevent families from going through this horrible experience.…

    • 1245 Words
    • 5 Pages
    Good Essays
  • Satisfactory Essays

    This condition can be tested for before a baby is born during an ultrasound (a scanning of inside the stomach of a pregnant woman). While checking the baby or fetus during an ultrasound, the…

    • 432 Words
    • 2 Pages
    Satisfactory Essays
  • Good Essays

    The Human Genome project, a revolutionary study that spanned over 13 years, hoped to discover more about the DNA of humans. The study's main goal was to provide new information to help with the diagnosis, treatment and prevention of genetic disorders. From the substantial amount of information and knowledge acquired from the project, new ways to test for genetic disorders, and the probabilities of inheriting disorders was gained. Gene testing, which involved taking a sample of a persons DNA, helped screen for a number of different disorders and problems. Before genetic testing, couples at risk of conceiving a child with a particular genetic disorder would have to initiate the pregnancy and then undergo the testing, faced with the dilemma of terminating the birth if the results weren't good. But because of the new technology available, with the combined effort of IVF, sperm and egg cells can be removed from both individuals, and the eggs would then be fertilized within a laboratory. The embryo's would then be tested for genetic mutations,…

    • 701 Words
    • 3 Pages
    Good Essays
  • Good Essays

    This article discusses the study of causation and developmental course of Down syndrome. It measures the evidence based on treatments and/or therapies that one should consider during a psycho-educational evaluation. Down syndrome is the most common genetic disorder in children and occurs in 1 out of 600 live births. It is the leading cause of cognitive disorders and is associated with mild to moderate learning disabilities. Most all individuals with Down syndrome have noticeable physical characteristics including a flattened face, upward slanting eyes, small mouths, short broad hands and fingers, etc. Most individuals with Down syndrome also suffer from speech impairment.…

    • 419 Words
    • 2 Pages
    Good Essays
  • Good Essays

    This disease can be diagnosed at birth and testing is available to identify whether the person…

    • 631 Words
    • 3 Pages
    Good Essays
  • Powerful Essays

    This final paper will discuss the ongoing debate of genetic/prenatal testing. Procedures for genetic/prenatal testing have been available since the early 1970's (Press, 2008, pp. 73-78). Genetic testing identifies abnormalities or changes in the chromosomes and genes. This type of testing is used to confirm or deny a suspected genetic condition or used to predict a person's chances of developing or passing on a certain disorder (Grant, 2000). Once the woman wants to go ahead with the genetic testing, a primary care doctor or genetic specialist places an order for the test. Genetic testing is often done as part of a genetic consultation (Press, 2008, pp. 73-78). It is very important that the patient knows every aspect of the procedure including…

    • 1673 Words
    • 7 Pages
    Powerful Essays
  • Good Essays

    Since the test involves taking only a small blood sample, where a person’s DNA can be found, these tests have a minimal health risk. Genetic testing was initially used in pregnancies to test for diseases like Down's Syndrome and other genetic disorders (“What are the...”). However, thanks to more recent improvements, genetic testing has come to display several weaknesses and strengths. The genes that can be obtained from infants can notify parents of possible physical deficiencies, while others may show physical advantages (Stein).…

    • 478 Words
    • 2 Pages
    Good Essays
  • Good Essays

    Down Syndrome is “a genetic deformity” (Holliday) that occurs in the DNA. Many moms say that the first time they noticed their child had Down Syndrome…

    • 891 Words
    • 4 Pages
    Good Essays
  • Good Essays

    I think that Pre-Birth child screening would be a great tool to use for adults who are planning to have children. To Know with what traits your child are going to have is a great thing, because you can see its strengths and its weaknesses, and you can grow on their strengths. An Example would be to have a child who was born with great muscles in their arms; you could as a child put them into sports such as swimming or tennis, sports that require good arm muscles.…

    • 632 Words
    • 3 Pages
    Good Essays
  • Good Essays

    Prenatal Testing Ethics

    • 682 Words
    • 3 Pages

    - A cost compression between invasive and non¬-invasive DNA testing should be mention in this article .Because there is some uncertainty around the incorporation of non-invasive prenatal testing into current strategies for prenatal screening and diagnosis.…

    • 682 Words
    • 3 Pages
    Good Essays
  • Good Essays

    The estimated incidence of Down syndrome is between 1 in 1,000 to 1 in 1,100 live births. Each year approximately 3,000 to 5,000 children are born with this chromosome disorder. It is believed there are about 250,000 families in the United States who are affected by Down syndrome.…

    • 1276 Words
    • 6 Pages
    Good Essays
  • Good Essays

    Down Syndrome

    • 3144 Words
    • 13 Pages

    The Judicial Act of 1781 was passed by Congress to allow the Supreme Court to hear original jurisdiction cases involving the President. Ultimately, this law was challenged in the courts and ruled unconstitutional. Which constitutional principle is involved?efenfm vkfjenv;kefjwn vkefvk;rbnvk;rfnblrkngbvkrgnvkj fv fdvknrfvlrknvlrknblrknbkrnb rb rfvfvfvslkdddfelkfmlewrmflermnflekrnglekrnglekngleknglkenlng-…

    • 3144 Words
    • 13 Pages
    Good Essays
  • Good Essays

    Developmental Science

    • 891 Words
    • 4 Pages

    Two procedures can help parents have healthy children, genetic counseling and prenatal diagnosis. In genetic counseling, the couple is able to assess their chances of having a child that has some type of disorder; prenatal diagnosis allows the detection of problems before birth that may cause complications throughout the lifespan, i.e. heart deformities, and the doctor may perform surgery in order to produce a healthy child.…

    • 891 Words
    • 4 Pages
    Good Essays
  • Better Essays

    This is one of the most interesting genetic diseases in the world, and yet there is no cure for it. This disease can affect people drastically, or sometimes very little at all. Although there is no way to treat it, it can be helped, and there are many programs to help. This complex genetic disease is called down syndrome.…

    • 1419 Words
    • 6 Pages
    Better Essays