Sequence: CCCCTGCTGGGAGTGGGGCTGAACACGACAATTC
Sequence ID/Fragment Code: 6649013
Answers:
1. Identify the gene from which the query sequence originates (Name of gene)
- Homo sapiens interleukin 2 receptor, gamma (severe combined immunodeficiency (IL2RG), mRNA
- See Appendix 1
2. Provide the full protein sequence encoded by the gene.
- >gi|4557882|ref|NP_000197.1| cytokine receptor common subunit gamma precursor [Homo sapiens]
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM
NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR
QATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSL
PSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVY
FWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP
CNQHSPYWAPPCYTLKPET
- See Appendix 2
3. Are different splice variants known for this gene?
- Yes there are different splice variants.
- See Appendix 3
4. What human disease has been connected to this gene?
- IL2RG can cause X-linked severe immunodeficiency (XSCID) as well as Xlinked combined immunodeficiency (XCID).
- See Appendix 4
5. Calculate molecular weight (kiloDalton kD) and calculated pI of the protein.
- The molecular weight is 42287.00kD and the calculated pI is 5.90.
- See Appendix 5
6. Provide the reference for a recent publication involving the identified gene.
- Davé, Akagi, Utpal P., Keiko. "Murine Leukemias with Retroviral Insertions at Lmo2 Are Predictive of the Leukemias Induced in SCID-X1 Patients Following Retroviral Gene Therapy."
PubMed Central . (2009): Print.
-See Appendix 6
7. Are there homologues for the identified gene in other systems? Identify one homologue in a invertebrate system (if there is none, provide a vertebrate homologue).
- Yes there are homolgues. The IL2RG gene is conserved in chimpanzee, dog, cow, mouse, rat, chicken, and zebrafish.
- See appendix 7
8. What is the function (e.g. transcriptional regulation, transmembran signaling, kinase, protease etc. of the protein(s) encoded by the gene.
- The function of the protein encoded by the gene is that it is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7, and -21, and is referred to as the common gamma chain.
- See appendix 8
9. Generate a protein sequence alignment for one of the identified putative protein products with at least one similar invertebrate protein (if there is none, use a vertebrate homologue.)
- MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNED-----TTADFFLTTMPTDSLSVST 54
FFLTSTPAGTLDVST 60
****.**: ***************..:***.****
MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGD
* .*****: *:.:*.***
- See Appendix 9
10. Generate a secondary structure prediction for one identified protein.
10
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM cccccccchhhhhhhhcccccccceeeeecccccccccheeeeccccccceecccccccheeeeeeeecc NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR cccccccccccccceeeeeeecccccccccccchheechccccchhhhhhheeeeeeeeeeecccccchh QATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSL hhhhhhhhhhhecccccccccccccchhhehhccchhhhhhhhhheeeeccccccccccccccccececc 2
PSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVY ccccccceeeeeeeecccccccccccccccccccccccccccccchhhhhhhhheehcchhhhhhhhhhh FWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP hhhhhhccccccchchhhhhhhhccccccccchhhcchhcccccccceeeeeeccccccccccccccccc CNQHSPYWAPPCYTLKPET
Ccccccccccccccccccc
- See Appendix 10
Appendix Is Listed Below On Following Pages
Appendix 1
Website: http://blast.ncbi.nlm.nih.gov/Blast.cgi
Appendix 2
Website: http://www.ncbi.nlm.nih.gov/protein/4557882?report=fasta
Appendix 3
Website: : http://uswest.ensembl.org/Homo_sapiens/Gene/
Summary?g=ENSG00000147168;r=X:70327254-70331958
Appendix 4
Website: http://www.ncbi.nlm.nih.gov/sites/entrez?Db=gene&Cmd=retrieve&dopt=full_report& list_uids=3561 Appendix 5
Website: http://us.expasy.org/cgi-bin/pi_tool
Appendix 6
Website: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2679194/?tool=pmcentrez
Appendix 7
Website: http://www.ncbi.nlm.nih.gov/sites/entrez?Db=gene&Cmd=retrieve&dopt=full_report& list_uids=3561 Appendix 8
Website: http://www.ncbi.nlm.nih.gov/sites/entrez?Db=gene&Cmd=retrieve&dopt=full_report& list_uids=3561 Appendix 9
Website: http://www.ebi.ac.uk/Tools/es/cgi-bin/clustalw/result.cgi?tool=clustalw&jobid=clustalw-!
20101203-1611481188&poll=yes
Appendix 10
Website: http://npsa-pbil.ibcp.fr/cgi-bin/secpred_hnn.pl
You May Also Find These Documents Helpful
-
g. The nucleic acid which picks up amino acids in the cytoplasm and then takes them to…
- 306 Words
- 3 Pages
Satisfactory Essays -
3. Name the piece of equipment used to obtain the cells. Cheek Buccal Swab to release cells from inside of mouth.…
- 1676 Words
- 7 Pages
Good Essays -
DNA stands for Deoxyribonucleic acid and looks like a spiral. The spiral is also known as a double helix. The strands are made up of our genetic information, composed of genes and chromosomes. There are four bases divided among purines and pyrimidines. On the purines there are Adenine (A) and Guanine (G). On the pyrimidines there are Cytosine (C) and Thymine (T). The base pairs are Adenine and Thymine (A-T) and Cytosine and Guanine (C-G). DNA is found in the nucleus of every human cell. Humans have 46 chromosomes. When a cell reproduces, the chromosomes get copied and distributed to each offspring.…
- 494 Words
- 2 Pages
Good Essays -
There could be genome defects that is causing something in the immune system no to produce these antibodies or the cells.…
- 665 Words
- 3 Pages
Satisfactory Essays -
Based on this graph it is possible to observe that the bacteria experienced exponential growth up until the introduction of bacteria phages. Once this virus was introduced the bacteria heavily declined while the virus began its exponential increase. As time went on he bacteria began to fight back and started to overcome the virus and began reproducing again, elevating their numbers. After the bacteria “fought back” the viruses began reproducing in non resistant cells and that is why they appear to have entered a co-inhabitance state.…
- 267 Words
- 2 Pages
Satisfactory Essays -
Gene and Gob have a verbal sales contract or agreement for the purchase of the ring in the amount of $800.00. Since it seems that the contract is not in writing, there is no enforceable contract. According to the Statue of Frauds, the contract must be in writing for “agreements to sell personal property for $500 or more.” (Liuzzo, 2016, p. 203)…
- 225 Words
- 1 Page
Good Essays -
The chapter Jump into The Gene Pool tells us about the random modifications that genetics and DNA, suffer due to mutation or gene jumping. Exist several causes by which gene can jumping occur: environmental stress genes or a disorder affecting their motion. At the same time, through this reading I have gotten a better understanding about the jumping DNA, which is a small sequence of DNA that move itself within the genome of the cell. Also, I found very interesting the creation of the first vaccine by Edward Jenner, theories like the Weismann Barrier and other concepts that helped scientists to have a better understanding of antibodies, genes and viruses.…
- 779 Words
- 4 Pages
Good Essays -
The concept of thrifty genes by itself is one amazing thing our body can do. A scientific article titled “Eating, exercise, and “thrifty” genotypes; connecting the dots toward an evolutionary understanding of modern chronic diseases” by Chakravarthy and Booth is an example of an essay that explores the concept of Thrifty genes and uses this concept to determine the understanding of chronic diseases that occur at present. The beginning of the paper is mostly focused on the objectives of using information from the past to figure out things such as the chronic disease that are present today. Thrifty gene according to the dictionary are “genes which enable individuals to efficiently collect and process food to deposit fat during periods of food…
- 469 Words
- 2 Pages
Good Essays -
In the movie, Cracking the Genetic Code, we learn that people can discover their likeliness for illnesses, diseases, cancer, and more. In this age scientists are discovering so many new things from a single strand of DNA. Finding out that you are missing a nucleic acid in your genes, or finding out you have an extra codon can change your life forever. Everyone has an opinion on keeping genes a secret or letting them out to the public, this essay will show the consequences of getting your genomes tested.…
- 352 Words
- 2 Pages
Good Essays -
The purpose of this report is to inform dog breeders of a very common genetic disease known as Progressive retinal atrophy (PRA). The report will also inform buyers of the disease so they are aware of the disorder and they can check to dog’s pedigree for the disease. PRA could affect any dog, as a result of this it is recommended that the offspring should be examined by a board-certified veterinary ophthalmologist and screened for the existence of the disorder.…
- 1262 Words
- 6 Pages
Better Essays -
Introduction The transcriptome is defined as the complete set of transcripts in a cell, and their quantity, for a specific developmental stage or physiological condition. It includes all the mRNA transcripts in a cell, reflecting genes that are actively expressed at any given time. An understanding of the transcriptome is essential for interpreting the functional elements of the genome and the development and disease. The key aims of transcriptomics are: cataloguing all species of transcript; determining gene transcriptional structure; and quantifying expression levels of each transcript during development and under different conditions (Marguerat, S, 2008).…
- 4545 Words
- 19 Pages
Powerful Essays -
space, our bodies, and our existence. Man has gone as far as to the moon, and cloning.…
- 2421 Words
- 10 Pages
Better Essays -
Companies around the world face challenges both externally and internally. Externally, companies have to create, manufacture, and distribute a product appealing to a targeted group of companies and in some cases venture out to the individual population. Internal challenges stem from the Chief Executive Officer’s (CEO), board members, team leaders, production designers, sales representatives, and the employee population. Some challenges presented can be the light of a new idea and other challenges can be the beginning of the unraveling of a team, project, or company. No matter what challenges a company may face, transformational leadership and organizational cultures play pivotal roles on how the challenges are managed and what direction the company is headed. The leadership is the foundation of a company. How the leadership addresses challenges or issues will determine the work environment for all employees and the success of the company. Gene One is a company facing these very issues.…
- 2376 Words
- 10 Pages
Powerful Essays -
• Each is transmitted from one generation to the next as a discrete, unchanging unit…
- 2489 Words
- 10 Pages
Good Essays -
3) “Cloning.” National Genome Research Institute. 12 March 2009. Web. 26 July 2009. http://www.genome.gov/25020028#8 (accessed 02/04/2012)…
- 2680 Words
- 11 Pages
Powerful Essays