"3 page book reports" Essays and Research Papers

Sort By:
Satisfactory Essays
Good Essays
Better Essays
Powerful Essays
Best Essays
Page 8 of 50 - About 500 Essays
  • Better Essays

    The Goal Book Report

    • 1180 Words
    • 5 Pages

    Angelina Tambunan ACCT 508 Book Report ‘The Goal’ I. Summary The story takes place at a fictitious town called Bearington where the Uniware manufacturing plant of the UniCo Company is situated. Whatever products the plant manufactures was not mentioned in the novel. The plant is headed by the plant manager Alex Rogo who is also the lead character of the novel. The problems begin when one upset customer approaches Alex’s boss‚ Bill Peach about a very late order. Actually Alex’s plant has

    Premium Bottleneck Choke point Project management

    • 1180 Words
    • 5 Pages
    Better Essays
  • Satisfactory Essays

    India Book report

    • 599 Words
    • 2 Pages

    Harkirat Dhaliwal Ms. Macdonald SJ8 20th November 2013 India The title of the book is India. It was written by Marilynn G. Barr. The illustrator and picture researcher is Jaimie Holl. It was published by Lorenz Educational Press in 2003. The genre is non- fiction. It includes 48 pages to read. This book is about the country India in Asia. The main idea is to tell you about many different features of India for example landscapes‚ climate and weather‚ natural resources‚ population

    Premium Taj Mahal Mughal Empire India

    • 599 Words
    • 2 Pages
    Satisfactory Essays
  • Better Essays

    Guts Book Report

    • 1704 Words
    • 7 Pages

    Hurd‚ Robyn-Alexis Prd. 3 Book Report: Guts by: Gary Paulsen General Information If I could rename this book‚ I would probably call it Close Calls because Gary Paulsen‚ the main character‚ has survived countless dangerous situations that should have ended with his death. The main setting‚ where most of those incidents have occurred‚ is the woods of Minnesota and occasionally Alaska. To me‚ it feels that Paulsen is just as amazed at his

    Premium Character Protagonist Gary Paulsen

    • 1704 Words
    • 7 Pages
    Better Essays
  • Good Essays

    Stolen Book Report

    • 389 Words
    • 2 Pages

    Stolen by Lucy Christopher teaches its readers to not misinterpret someone’s demeanor on the outside but to look deeper within their soul and understand their perspective. To not praise someone based on what the look like on the outside without getting to know them on the inside. In the beginning‚ a sixteen year old teenager by the name of Gemma Toombs is struck by a guy from his looks and his icy blue eyes but comes to find out her drugged her. Later she calls him kidnapper‚ a psycho‚ and a stalker

    Premium Family Love Marriage

    • 389 Words
    • 2 Pages
    Good Essays
  • Better Essays

    Book Report Phi103

    • 1397 Words
    • 4 Pages

    Marcia Offin Dr. Benjamin Arah Philosophy 103 - 555 Book Report December 5th‚ 2014 Book Title – When Cultures Collide By Cosmas Uchenna Nwokeafor When Cultures Collide by Cosmas Uchenna Nwokeafor About the Author‚ Dr. Cosmas Uchenna Nwokeafor was born in Port Harcourt‚ Rivers State‚ Nigeria. Before his arrival in the United States in 1985‚ he earned a National Certificate in Education at the Alvan Ikoku College of Education‚ Owerri‚ Nigeria. He earned his Bachelor’s Degree in Journalism

    Premium United States African people Country music

    • 1397 Words
    • 4 Pages
    Better Essays
  • Satisfactory Essays

    Gene Report 3

    • 488 Words
    • 4 Pages

    EQSVDYRHKFSL PSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVY FWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP CNQHSPYWAPPCYTLKPET - See Appendix 2 3. Are different splice variants known for this gene? - Yes there are different splice variants. - See Appendix 3 4. What human disease has been connected to this gene? - IL2RG can cause X-linked severe immunodeficiency (XSCID) as well as Xlinked combined immunodeficiency (XCID). - See Appendix 4 5. Calculate

    Free Protein DNA

    • 488 Words
    • 4 Pages
    Satisfactory Essays
  • Better Essays

    Alc Book Report

    • 911 Words
    • 4 Pages

    4 Weddings and a funeral Is a comedy fiction book written by Richard Curtis. Number of pages:67 level 5. Summary Four Weddings and a Funeral was the most successful film of 1994. All over the world‚ people were charmed by this romantic English comedy. The Penguin Reader version has been written from the novelization of the film‚ and is a very‚ very funny book. Charles is a charming and good-looking young Englishman‚ with a delightful group of friends. But he has a problem – although he loves

    Premium Marriage Wedding Love

    • 911 Words
    • 4 Pages
    Better Essays
  • Better Essays

    Into the Wild Book Report

    • 998 Words
    • 4 Pages

    Into The Wild Book Report A New Life “In April 1992 a young man from a well-to-do family hitchhiked to Alaska and walked alone into the wilderness north of Mt. McKinley. His name was Christopher Johnson Mcandless. He had given $25‚000 in savings to charity‚ abandoned his car and most of his possessions‚ burned all the cash in his wallet‚ and invented a new life for himself.” Into The Wild is a book about a young man who travels across some of the most unforgiving terrain to find his place

    Premium Into the Wild Jon Krakauer

    • 998 Words
    • 4 Pages
    Better Essays
  • Satisfactory Essays

    Book Report-Fiction

    • 267 Words
    • 2 Pages

    Debby Shum 9B (12) Book report-Fiction Pre-reading task: Title: Flour Babies Author: Anne Fine Publisher: The Penguin Group Year of Publication: 1992 Post-reading Task: My comments: My favorite character is Simon Martin because he was willing to solve problems and found the final answer. He was mature and self-disciplined‚ always helping others‚ considerate and thoughtful to others. We should learn from him. The most interesting and memorable scene in the book is Simon hurdled all

    Premium Psychology Problem solving English-language films

    • 267 Words
    • 2 Pages
    Satisfactory Essays
  • Good Essays

    Flipped Book Report

    • 681 Words
    • 3 Pages

    The book that I recently loved was "Flipped" By Wendelin Van Draanen. Flipped is a fiction book and contains 212 pages‚ I started the book on May 2nd and finished it the week later.Wendelin Van Draanen was born January 6 in Chicago‚IL and is still living. Wendelin Van Draanen’s previous jobs was a fork lifter(a fork lifter is a person who works at a construction site lifting up heavy weights off the ground with a mechanical machine)‚high school computer teacher‚ and even was a singer in a rock band

    Premium Ralph Fiennes Psychology

    • 681 Words
    • 3 Pages
    Good Essays
Page 1 5 6 7 8 9 10 11 12 50