"A portion of a specific dna molecule consists of the following sequence of nucleotide trpilets" Essays and Research Papers

Sort By:
Satisfactory Essays
Good Essays
Better Essays
Powerful Essays
Best Essays
Page 1 of 50 - About 500 Essays
  • Good Essays

    doe not involve changes in the underlying DNA sequence. This means a change in phenotype occurs‚ which changes the observable characteristics of an organism‚ while the genotype of the organisms stays the same. Although‚ epigenetic changes are regular and naturally occurring‚ other factors can influence the phenotype of an organism. Some of these factors include age‚ environment‚ and disease. However‚ these factors can cause physical modifications to the DNA and its associated structures‚ which result

    Premium DNA Gene Genetics

    • 586 Words
    • 3 Pages
    Good Essays
  • Good Essays

    The DNA molecule is often referred to as “The Blueprint of life”. Discuss. [SEP‚ 1999] Synopsis DNA structure Why is DNA called “blueprint” Features of the genetic code ------------------------------------------------------------------------------------- Deoxyribonucleic acid (DNA) is a vital component of both eukaryotic and prokaryotic cells. A blueprint is a detailed drawing or map which identifies and directs the construction and development of a building or an object. DNA is the hereditary

    Premium DNA

    • 848 Words
    • 4 Pages
    Good Essays
  • Satisfactory Essays

    DNA Sequence Analysis

    • 280 Words
    • 2 Pages

    1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP

    Premium Gene DNA Amino acid

    • 280 Words
    • 2 Pages
    Satisfactory Essays
  • Satisfactory Essays

    Nucleotide Triplet

    • 516 Words
    • 3 Pages

    BIOLOGY A portion of a specific DNA molecule consists of the following sequence of nucleotide triplets: TAC GAA CTT CGG TCC This DNA sequence codes for the following short polypeptide: methionine - leucine - glutamic acid - proline - arginine Describe the steps in the synthesis of this polypeptide. What would be the effect of a deleltion or an addition in one of the DNA nucleotides? What would be the effect of a substitution in one of the nucleotides?

    Premium DNA Polymerase chain reaction Amino acid

    • 516 Words
    • 3 Pages
    Satisfactory Essays
  • Good Essays

    DNA is the primary genetic material that makes each individual different. DNA is the molecule that makes up chromosomes each pair of chromosomes contains DNA from one parent. DNA is found in the nuclei of eukaryotic cells and prokaryotic cells in living organisms. DNA is so important it is unable to leave the nucleus therefore the body makes RNA to carry information out into the cytoplasm. The three major components of DNA nucleotide monomers are phosphate‚ 5 carbon ring sugar (de-oxyribose) and

    Premium DNA Gene Genetics

    • 343 Words
    • 2 Pages
    Good Essays
  • Satisfactory Essays

    structure of a nucleotide. A nucleotide is a sugar molecule that has 3 parts including a simple sugar‚ a phosphate group and a nitrogenous base. Nucleotides join together forming long chains‚ with the phosphate group of nucleotide bonding to the deoxyribose sugar of an adjacent nucleotide. 3. Explain why the structure of a DNA molecule is often described as a zipper. The structure of a DNA molecule is often described as a zipper because it is made of tow chains of nucleotides held together by

    Premium DNA Gene RNA

    • 314 Words
    • 2 Pages
    Satisfactory Essays
  • Good Essays

    Consider the following double-stranded DNA sequence: 5’-CAG AAG AAA ATT AAC ATG TAA-3’ 3’-GTC TTC TTT TAA TTG TAC ATT-5’ If the bottom strand serves as the template‚ what is the mRNA sequence produced by transcription of this DNA sequence and Why? 5’-CAG AAG AAA AUU AAC AUG UAA-3’ mRNA sequence 3’-GTC TTC TTT TAA TTG TAC ATT-5’ DNA template strand We get the mRNA sequence due the transcription process‚ which gives us the RNA bases that are complementary to the DNA template

    Premium DNA Gene RNA

    • 950 Words
    • 4 Pages
    Good Essays
  • Better Essays

    unlimited amplification of specific nucleic acid sequences that may be present at very low concentrations in very complex mixtures. Within less than a decade after its initial development‚ it has become a critical tool for all practicing molecular biologists‚ and it has served to bring molecular biology into the practice of many other fields in the biomedical sciences and beyond. The reasons are several fold. First‚ PCR provides the ultimate in sensitivity — single DNA molecules can be detected and analyzed

    Premium Polymerase chain reaction DNA Genetics

    • 9771 Words
    • 40 Pages
    Better Essays
  • Good Essays

    Dna

    • 998 Words
    • 4 Pages

    DNA DNA‚ or Deoxyribonucleic Acid‚ is described‚ in Encarta Encyclopedia as a genetic material of all cellular organisms and most viruses. DNA carries the information needed to direct protein synthesis and replication. Protein synthesis is the production of the proteins needed by the cell or virus for its activities and development. Replication is the process by which DNA copies itself for each descendant cell or virus‚ passing on the information needed for protein synthesis. In most cellular

    Free DNA

    • 998 Words
    • 4 Pages
    Good Essays
  • Powerful Essays

    Molecules: Atom and Ans

    • 1149 Words
    • 5 Pages

    Anatomy & Physiology Name ________________________________ Organic Molecules Review Multiple Choice Identify the letter of the choice that best completes the statement or answers the question. ____ 1. Ions are a. electrically neutral fragments of a molecule that has been split apart. b. polar molecules c. radioactive isotopes that give off alpha‚ beta‚ or gamma d. charged atoms or molecules that have gained or lost electrons. ____ 2. Sodium has eleven protons. How many electrons

    Premium Atom DNA Covalent bond

    • 1149 Words
    • 5 Pages
    Powerful Essays
Previous
Page 1 2 3 4 5 6 7 8 9 50