Sikkim Manipal University Subject: Management Process and Organisational Behaviour Subject code: MB0038 Book ID B1621 Question Paper Code: Time: 3 hours PART A – 1 MARK QUESTIONS Answer all questions. Each question carries 1 mark 50 * 1= 50 Marks Max.Marks:140 1. An organisation is a __________ system of people who are structured and meet specified goals. a. Geographical b. Social c. Private d. Specified 2. Building a vision involves the joint efforts of the owner and ____________ of the organisation
Premium Management Organizational culture Organization
1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
between teacher and student and parent and child and parent and teacher and so on. Knowing when to respond and when to let go and let them find out on their own is a dance‚ a subtle communication of letting each other know what our needs are and how we can help each other. Interview‚ teacher (Henry‚ 1996‚ p. 182) While the value of the home/school partnership is universally accepted‚ it is not always easy to promote or maintain.(1) As we have moved from small communities with intimate connections to
Free Sociology Morality
Thursday‚ 20 February 2014 Public Law! The Fixed-Term Parliaments Act 2011 - Enacted on September 15 as part of the Coalition’s agreement of constitutional and political reform. This act removes the Executives prerogative power to dissolve Parliament and states that Parliamentary general elections will instead take place every 5 years under S1. Prior to this‚ the Septennial Act 1716 extended the maximum duration of Parliament from 3 years to 7 years. Dicey used this as a prime example
Premium Separation of powers Election Parliament
39 Steps Essay During a musical event shots are fired. A scared woman asks to go home with Richard. He takes her to his apartment. She is nervous and tells him she is a British spy and that two men are after her and they are waiting outside his building. One of the men is missing his little finger. Richard allows her to stay and turns up dead with a knife in her back by morning. She was holding a map with a certain area circled and mumbled something about the 39 steps. Richard sneaks
Premium English-language films Alfred Hitchcock Black-and-white films
false (and if one or more of the premises are false – the argument is not sound) Validity – governed by the form of an argument Soundness – governed by the form and truth of the premises Another characteristic of categorical is that propositions can be universal or particular (Universal = refers to all things included/not included in a category; particular = when only one/some are included/not included in a category) Example: Universal All students are people All A are B No dogs are
Premium Logic
WEEK 3 Discussion Question 1: Just Following Orders? Do you believe the sentence she received is just? Wasn’t she simply following orders? Why did Ms. Vinson make the ethical decisions that she made? In my opinion‚ from the two articles read I do not believe that the sentence of 5 months in prison that Ms Vinson received coincided with her level of involvement. Ms Vinson was the Senior of Corporate Reporting Department; for two years she chooses to continue to misrepresent and inflate
Premium Ethics Business ethics
Steps To Christ Steps to Christ is a book that concentrates on the life of Jesus Christ and the love that God pours down on us by his amazing grace and his beautiful nature. During the first few chapters of the book it explains to us the way to come to God. After this the rest of the book explains how to engage and remain true to God. One vivid parallel I got from the book was that even though plants have thistles and vines have thorns‚ there are beautiful flowers still grow on them. This works
Premium Jesus Ellen G. White Christian terms
ZINN CHAPTER 1 - STUDY QUESTIONS 1. According to Zinn‚ what is his main purpose for writing A People’s History of the United States? 2. What is Zinn’s thesis for pages 1-11? 3. According to Zinn‚ how is Columbus portrayed in traditional history books? 4. Why does Zinn dispute Henry Kissinger’s statement: “History is the memory of states?” 5. What is Zinn’s basic criticism of historian Samuel Eliot Morison’s book‚ Christopher Columbus‚ Mariner? 6. What major issues does Bartolome
Free Christopher Columbus United States Indigenous peoples of the Americas
follow directions so that everything can go in an orderly fashion‚ it’s important do because they know what’s going to happen if you don’t. It’s important to follow directions because if you don’t something can go wrong‚ it’s important follow directions because if you don’t you’ll get in trouble‚ and it’s also important to follow directions because if you don’t you’ll be writing this essay too. It’s important to follow directions because if you don’t something can go wrong. If you decide to cross the
Premium Writing Essay Marriage