1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
ZINN CHAPTER 1 - STUDY QUESTIONS 1. According to Zinn‚ what is his main purpose for writing A People’s History of the United States? 2. What is Zinn’s thesis for pages 1-11? 3. According to Zinn‚ how is Columbus portrayed in traditional history books? 4. Why does Zinn dispute Henry Kissinger’s statement: “History is the memory of states?” 5. What is Zinn’s basic criticism of historian Samuel Eliot Morison’s book‚ Christopher Columbus‚ Mariner? 6. What major issues does Bartolome
Free Christopher Columbus United States Indigenous peoples of the Americas
could change everything. However‚ from my point of view‚ technology has majorly changed our life. Food has always been the most import thing as same as water to human life. If food has changed‚ people would change too. From the film called “Food Sequence”‚ I can tell there was a big change that happened to what or how we eat over the decades. Besides‚ obesity‚ GMO and food safety have always been the subject that people and scientist
Premium Science Technology Engineering
My own development during my 18 and a half years of being alive‚ relates to the theory of human development created by Urie Bronfenbrenner. Bronfenbrenner’s theory of human development is also known as the PPCT model. The PPCT model has four interrelated components‚ which are Process‚ Person‚ Context and Time. Bronfenbrenner (2005). These are the proximal processes that make up the characterisitics of a child‚ the stimulation of a child’s development and the time in which a child matures and develops
Premium Jean Piaget Developmental psychology Theory of cognitive development
Acejan L. Jadie B.S.E. 32 Motivating People to Read Prolonged enthusiasm in certain activity like reading is hard to accomplish if someone is not encourage enough to do it. Each person has own extent or period of time focusing his attention to read. In reading‚ it may only require few muscles to do but tiring if persisted. One may be good in comprehending texts and articles but numbers are always in the game and better if partnered with comprehension. Meaning‚ the more you read with comprehension
Premium Motivation Educational psychology
The Effects of Drug and Alcohol Abuse ENG 121 November 26‚ 2012 The Effects of Drug and Alcohol Abuse Alcoholism and drug abuse is a devastating disease that affects not only those that suffer from it‚ but also all those around them. Alcohol and drug abuse is very prevalent in the US; it takes many shapes‚ forms‚ and knows no color. This abuse can start as young as 9 or 10 years old and can continue until death. This disease affects many different types of people. It affects women‚ men‚ children
Premium Drug addiction Alcoholism Addiction
Battleship Potemkin filmed in 1925. This film is about the uprising of the working class in the 1905 revolution‚ mainly the revolt on the Potemkin and the attack on the citizens of Odessa. One of the most powerful scenes in this film is the Odessa Steps Sequence. Eisenstein casted the people in this film based on their physical appearance‚ not their experience. He put out an advertisement looking for three types of people: Jewish Women‚ men who look good natured‚ and men who have squinty eyes and a rude
Premium Film editing Soviet Union
According to Levinson‚ what four developmental tasks must middle-aged adults confront in order to rebuild their life structure? Provide examples to illustrate all four. What are possible selves‚ and why are they important in middle adulthood? Levinson’s seasons of life theory depicted adult development as a sequence of qualitatively distinct areas separated by transitions (Berk‚ 2014‚ pg 470). A key concept in Levinson’s theory is the life structure (Berk‚ 2014‚ p470). The life structure
Free Middle age Adult Old age
Developmental Psychology Reading Notes Pages 260-230 -children go from knowing no lang in the first year to producing and comprehending complex constructions in their 3rd year -language is a that emerges is a natural language that refers to any lang spoken on a daily basis by a community -acquiring lang is so common it isn’t thought of as a crazy achievement -change in lang and change in how others speak to them -do certain langs guide certain thoughts? -Generativity= producing
Premium Word Learning Thought
Urie Bronfenbrenner is one of the most well-known psychologists alive. Now in his eighties‚ he has had an extremely long and productive career. Bronfenbrenner is most famous for his views on ecological psychology. Very briefly‚ he suggests that: • interactions with others and the environment are key to development‚ • we all experience more than one type of environment‚ including • the microsystem - such as a family‚ classroom‚ etc is the immediate environment in which a person is
Premium Developmental psychology Urie Bronfenbrenner Ecology