"Homo sapiens" Essays and Research Papers

Sort By:
Satisfactory Essays
Good Essays
Better Essays
Powerful Essays
Best Essays
Page 38 of 50 - About 500 Essays
  • Good Essays

    The Croods

    • 631 Words
    • 3 Pages

    sloth-like creature) to keep him company.  He spent his days learnig to survive on his own and inventing things to help with everyday life.  This ends when he meets Eep Crood. PLOT Eep (Emma Stone) is a girl in a family of Neanderthal Cavemen (Homo sapiens neanderthalensis) living and hunting in pre-historic times‚ talking about how her family is one of the few to survive‚ mainly due to the strict rules of her overprotective father‚ Grug (Nicolas Cage). In their cave home‚ Grug tells a story to the

    Premium Human Neanderthal Family

    • 631 Words
    • 3 Pages
    Good Essays
  • Powerful Essays

    Tracing Overpopulation Through the Historiographical Methods of Dr. Paul Ehrlich from the 1960’s to the 1990’s Tracing Overpopulation Through the Historiographical Methods of Dr. Paul Ehrlich from the 1960’s to the 1990’s While driving through the overpopulated streets of Delhi‚ India‚ Paul Ehrlich noticed just how many people were in the world. It took his family a couple of hours just to travel a short distance through the city. Take into consideration

    Premium World population Population Population growth

    • 2593 Words
    • 11 Pages
    Powerful Essays
  • Powerful Essays

    Early Civilizations

    • 2045 Words
    • 9 Pages

    Notes/Answers/Definitions/Examples/Sentences INTRODUCTION How long have human species existed? Human beings have some drawbacks Human beings have several distinctions Def: Paleolithic or Old Stone Age Evolution: Homo erectus Newest human breed: Homo sapiens sapiens Faced constraints Improvements Def: Culture (Migration) Spreading over earth’s surface -leaving- (Immigration) -coming in- Def: Mesothelic or Middle Stone Age THE NEOLITHTIC REVOLUTION Def: Neothelic

    Premium Human Evolution Nutrition

    • 2045 Words
    • 9 Pages
    Powerful Essays
  • Good Essays

    Racial prejudice is an insidious moral and social disease affecting peoples and populations all over the world. It is diagnosed by the cataloguing of its various symptoms and manifestations which include fear‚ intolerance‚ separation‚ segregation‚ discrimination‚ and hatred. While all of these symptoms of racial prejudice may be manifest‚ the single underlying cause of racial prejudice is ignorance. Historically‚ a race of people is defined as a population with distinguishable biological features

    Premium Race Discrimination Racism

    • 472 Words
    • 2 Pages
    Good Essays
  • Good Essays

    Teeth Evolution

    • 1323 Words
    • 6 Pages

    only one species exists today—Homo sapiens‚ or human beings. Dr. Alistair Evans and his colleagues based their study off of hominin tooth sizes while trying to figure out what rule governed the evolution and development of teeth in hominins. This study provides a development-based expectation to examine the evolution of the unique proportions of human teeth. While on their journey‚ Dr. Evans and his crew found two types of hominins: the species that we classify as Homo and australopiths. These scientists

    Premium Teeth Human Human evolution

    • 1323 Words
    • 6 Pages
    Good Essays
  • Good Essays

    Cro-Magnons Achievements

    • 486 Words
    • 2 Pages

    survive in such harsh and demanding conditions? Maybe these beings‚ thought to be the earlier versions of the Homo sapiens that we are today‚ were smarter than you would guess them to be‚ maybe they were just lucky‚ or maybe it was the many impressive accomplishments throughout their stages of development that aided in there survival. Though the five beings (Australopithecines‚ Homo habilis‚ Homo erectus‚ Neanderthal‚ and Cro-Magnon) were different from each other‚ they each had there place in the continuously

    Premium Human Human evolution Evolution

    • 486 Words
    • 2 Pages
    Good Essays
  • Good Essays

    Guns‚ Germs and Steel: The Fates of Human Societies written by Jared Diamond travels through the different aspects of human societies starting from modern human’s pre-Homo ancestors comparing the different variations that have occurred throughout time‚ ending at the modern Homo sapiens in the world today. The focus of this book is why some societies strive while other fail. Diamond looked at the different advantages and disadvantages of the areas these societies lived in and in his own words deriving

    Premium Sociology Human Natural environment

    • 935 Words
    • 4 Pages
    Good Essays
  • Good Essays

    South Africa

    • 819 Words
    • 4 Pages

    to South Africa around three million years ago became the first human-like inhabitants of the area now known as South Africa. Representatives of homo erectus gradually replaced them around a million years ago when they also spread across Africa and into Europe and Asia. Homo erectus gave way to homo sapiens around 100‚000 years ago. The first homo sapiens formed the Bushman culture of skilled hunter-gatherers. Around 2‚500 years ago Bantu peoples migrated into Southern Africa from the Niger River

    Premium South Africa Nelson Mandela

    • 819 Words
    • 4 Pages
    Good Essays
  • Satisfactory Essays

    Gene Report 3

    • 488 Words
    • 4 Pages

    Sequence ID/Fragment Code: 6649013 Answers: 1. Identify the gene from which the query sequence originates (Name of gene) - Homo sapiens interleukin 2 receptor‚ gamma (severe combined immunodeficiency (IL2RG)‚ mRNA - See Appendix 1 2. Provide the full protein sequence encoded by the gene. - >gi|4557882|ref|NP_000197.1| cytokine receptor common subunit gamma precursor [Homo sapiens] MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR

    Free Protein DNA

    • 488 Words
    • 4 Pages
    Satisfactory Essays
  • Good Essays

    Vertebrates

    • 4437 Words
    • 18 Pages

    3. Describe an amniotic egg and explain its significance in the evolution of reptiles and mammals 4. Explain why the reptile clade includes birds 5. Distinguish among monotreme‚ marsupial‚ and eutherian mammal. 6. Describe the evolution of Homo sapiens from australopith ancestors‚ and clarify the order in which distinctive human traits arose. 7. Explain the significance of the FOXP2 gene. Copyright © 2008 Pearson Education‚ Inc.‚ publishing as Pearson Benjamin Cummings Overview: Half

    Premium Primate Mammal

    • 4437 Words
    • 18 Pages
    Good Essays
Page 1 35 36 37 38 39 40 41 42 50