1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
1302 Mr. Glaesemann 15 April 2014 Characterization: The Breakfast Club A professor named Peter Drucker stated‚ ‘’the most important thing in communication is hearing what isn’t said.’’ The quote basically means the ability to read the emotions and nonverbal communication of another person increases the understanding and elevates relationships. A prominent writer and producer named John Hughes directed a movie called The Breakfast Club where five students with nothing in common are faced with
Free Adolescence Peer group Peer pressure
Explain the Difference Between Sequence of Development and Rate of Development and Why The Difference is Important. All children develop at different rates‚ information and sources are only guidelines. These help to monitor what children can and can’t do at certain stages in their lives. It also helps to plan effectively to ensure the child gets the attention they need‚ in the areas in which they find challenging. Physical development follows a definite sequence. A baby’s physical development may
Premium Childhood Child development Dyslexia
In the movie The Breakfast Club‚ five students are to spend the entire day together in detention. These five teenagers all come from extremely different backgrounds and social groups within their school. As the movie progresses they learn more about one another. This bond comes about due to the students trying to have fun while in detention. In the beginning ten minutes of the movie one can see the setting of a team form. This means that it was clear that there would be a plan of action made by
Premium High school Education Teacher
The Monroe Doctrine can be considered as the United States first major declaration to the world as a fairly new nation. The Monroe Doctrine was a statement of United States policy on the activity and rights of powers in the Western Hemisphere during the early to mid 1800?s. It was expressed during President Monroe ’s seventh annual message to Congress on December 2nd 1823. The Monroe Doctrine deterred European imperialist powers from encroaching upon the boundaries of the United States and established
Free United States James Monroe John Quincy Adams
1.1 Explain the sequence and rate of each aspect of development that would normally be expected in children and young people from birth – 19 years. Physical 0 -3 When a baby is born they are unable to hold their own head up however they will tilt their head towards light or noise within their first months. When spoken to they will react by looking at or watching you. As they develop they will be able to support their own head and wave their arms around and bring them together‚ the same with
Premium Self-esteem Child
Influence of a Legend: Marilyn Monroe Outline for Research Paper Thesis: Marilyn Monroe ’s status as a sex symbol and popular icon has greatly impacted many artists since her time‚ including Andy Warhol‚ Madonna‚ and even Britney Spears. I. Introduction a. Background b. Thesis II. Growth of Sex Symbol a. Becoming Marilyn Monroe b. Love Life III. Movie Star a. Achievements 1. Movies 2. Awards IV. Impact a. Andy Warhol b. Madonna c. Britney Spears V. Conclusion a. Her influence was
Premium Sociology Art Marilyn Monroe
ZINN CHAPTER 1 - STUDY QUESTIONS 1. According to Zinn‚ what is his main purpose for writing A People’s History of the United States? 2. What is Zinn’s thesis for pages 1-11? 3. According to Zinn‚ how is Columbus portrayed in traditional history books? 4. Why does Zinn dispute Henry Kissinger’s statement: “History is the memory of states?” 5. What is Zinn’s basic criticism of historian Samuel Eliot Morison’s book‚ Christopher Columbus‚ Mariner? 6. What major issues does Bartolome
Free Christopher Columbus United States Indigenous peoples of the Americas
Monroe and Molly were twins that never saw eye to eye even as kids they always bicker over anything little even though‚ they always make up in the end and are never apart seeing they are the only two kids of their parents that survived. their mother had a thin chance of having children so it was a high risk of the twins not being born so their parents saw them two as their little miracles‚ as Monroe and molly grew their parents had seen the twins were polar opposites of each other‚ Monroe being a
Premium Family Mother Parent
Marilyn Monroe Somebody once said that Marilyn Monroe played the best game with the worst hand dealt in the game of life. Marilyn Monroe‚ born Norma Jean Mortenson‚ personified Hollywood glamour with an unparalleled glow and energy that captivated the world. Brought into the world in a traumatic situation that would effect the later part of her life‚ she managed to become a legend. Marilyn was therefore great but misunderstood in many ways. Surpassing her stereotypical sex goddess appeal‚ Marilyn
Premium