1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
Since 1962 one of Hollywood’s famous icons Marilyn Monroe‚ death still remains as an unforgettable and compelled mystery. As the population discovers her death many became startled and speechless for her to become deceased at such a young age. Many had viewed her as a beautiful model and an actress who symbolizes as a sex symbol of the 1950’s. Although Marilyn Monroe had an unfortunate childhood by the negative impacts that led up to many difficulties over time she managed to fulfill many of her
Premium Marilyn Monroe United States Life
1.President Monroe articulated the Monroe Doctrine in his 1823 address to Congress primarily in order to A.respond positively to the recent Latin American revolutions B.rule out United States involvement in South America C.provide a rationale for United States intervention in the Isthmus of Panama D.warn European nations against further colonial ventures in the Western Hemisphere E.encourage Britain to help the fledgling Latin American states 2.Which of the following transportation developments
Premium United States Thomas Jefferson Monroe Doctrine
1.1 Explain the sequence and rate of each aspect of development that would normally be expected in children and young people from birth – 19 years. Physical 0 -3 When a baby is born they are unable to hold their own head up however they will tilt their head towards light or noise within their first months. When spoken to they will react by looking at or watching you. As they develop they will be able to support their own head and wave their arms around and bring them together‚ the same with
Premium Self-esteem Child
ZINN CHAPTER 1 - STUDY QUESTIONS 1. According to Zinn‚ what is his main purpose for writing A People’s History of the United States? 2. What is Zinn’s thesis for pages 1-11? 3. According to Zinn‚ how is Columbus portrayed in traditional history books? 4. Why does Zinn dispute Henry Kissinger’s statement: “History is the memory of states?” 5. What is Zinn’s basic criticism of historian Samuel Eliot Morison’s book‚ Christopher Columbus‚ Mariner? 6. What major issues does Bartolome
Free Christopher Columbus United States Indigenous peoples of the Americas
Monroe and Molly were twins that never saw eye to eye even as kids they always bicker over anything little even though‚ they always make up in the end and are never apart seeing they are the only two kids of their parents that survived. their mother had a thin chance of having children so it was a high risk of the twins not being born so their parents saw them two as their little miracles‚ as Monroe and molly grew their parents had seen the twins were polar opposites of each other‚ Monroe being a
Premium Family Mother Parent
Marilyn Monroe Somebody once said that Marilyn Monroe played the best game with the worst hand dealt in the game of life. Marilyn Monroe‚ born Norma Jean Mortenson‚ personified Hollywood glamour with an unparalleled glow and energy that captivated the world. Brought into the world in a traumatic situation that would effect the later part of her life‚ she managed to become a legend. Marilyn was therefore great but misunderstood in many ways. Surpassing her stereotypical sex goddess appeal‚ Marilyn
Premium
could change everything. However‚ from my point of view‚ technology has majorly changed our life. Food has always been the most import thing as same as water to human life. If food has changed‚ people would change too. From the film called “Food Sequence”‚ I can tell there was a big change that happened to what or how we eat over the decades. Besides‚ obesity‚ GMO and food safety have always been the subject that people and scientist
Premium Science Technology Engineering
Since the 1820s‚ the Monroe Doctrine has been the foundation of the U.S. policy toward Latin America. However‚ it has been interpreted many different ways. Some U.S. presidents have broadly interpreted it‚ expanding its meaning. Others have taken it to mean only what it states. In a speech to Congress in 1823‚ President James Monroe issued a new policy concerning the threat of European intervention to inhibit American sovereignty. This came to be known as the Monroe Doctrine‚ which became the cornerstone
Premium United States Spanish–American War Monroe Doctrine
The Monroe Doctrine is the foreign policy regarding domination of the America. This document was passed by President Fames Monroe in December 2‚ 1823. During this time‚ many of the countries in the South America already gain their independence from Europe. But the Europe still want to interfere. So President Monroe passed this doctrine to state the American standing point. The Monroe Doctrine stated that America would not allow or listen to any of the European intervention. It said that the intervention
Premium United States President of the United States World War II