before and he faced the dangerous crossing of the Atlantic. He had specific reasons for his motivation‚ he accomplished much and he dealt with those who doubted him in several ways. Generally scholars will say that the explorers of the new world were motivated by “God‚ Gold‚ and Glory.” Columbus himself wanted to get rich and prove that he was correct in regards to his views on world geography. The main way he was trying to get rich was by locating a faster route to the spice islands located in Asia. This
Premium
Persuasive Speech Outline on “Texting while driving” March 21st‚ 2013 I. Introduction A. The main premise of my argument is that no one for whatever reason should be texting while driving. B: Defining the issue: Distracted driving while texting 1. Texting and driving 2. Lack of concentration‚ losing focus on driving 3. Looking at texts and not paying attention to the surroundings scenery C: Standing on this issue? All drivers need to be aware of distracted driving and take steps to
Premium Text messaging Mobile phone Automobile
Communication 101 Persuasive Speech Outline Organization: Problem-Solution Audience analysis: My audience consists of one 39 year old female who is college educated and works part time. It also consists of one 37 year old college educated male who is also currently in the work force and one 18 year old female who attends trade school and is currently in the work force. They are all Christians. Topic: Living without God. Rhetorical Purpose: To inform my audience about what life with Christ can
Premium Jesus
Gun Control Speech Outline General Goal: I want to inform my audience Specific Goal: I want my audience to understand that gun control is not the answer to crime rates‚ suicide and homicide‚ but rather better and more mental health recognition and help and gun safety awareness. INTRODUCTION I. Columbine‚ Virginia Tech‚ Aurora‚ Newtown are just a few places where mass shootings have happened that have left people forever scarred and unable to forget. Because of these and other incidents
Premium Firearm United States Gun
Speech to Explain Outline Topic: Attraction Specific Purpose: To explain to the class why we may become attracted to someone and what happens in our body when we are. Thesis: There are certain theories as to why we become attracted to someone. When we are attracted to someone‚ our brains release specific chemicals‚ and we subconsciously let the person know we are attracted through body language. Introduction: Your heart starts to race. You fix both your hair and your shirt. Your pupils dilate
Premium Female body shape Body shape Physical attractiveness
Outline: Chapter 15 The importance of persuasion I. Persuasion is the process of creating‚ reinforcing‚ or changing people’s beliefs or actions. II. Persuasion has been studied for more than 2000 years III. When you speak to persuade you act as an advocate IV. By age 20‚ the average American has been exposed to 1 million television commercials-an average of 150 a day. Ethics and Persuasion I. Make sure your goals are ethically sound and that you can defend them II. Be
Premium Rhetoric Ethics Regulatory Focus Theory
Abortion I. Introduction: A. Attention Grabber: rhetorical question‚ story‚ quote‚ shock‚ scare‚ stats‚ allusion‚ etc.: Did you know that teenage girls are more than 24 times more likely to die from childbirth than from first trimester legal abortion? B. Why audience should care: Every girl is at risk of getting pregnant‚ and if parental consent is the reason for childbirth the effects hurt mother and father. C. Background Info.
Premium Abortion Pregnancy Human rights
1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
Organizing Your Speech (all info from Metcalf‚ 2001) FIRST…We’ll talk about: a) How to write good outline b) How to structure body of your speech SECOND…We’ll talk about what makes good Introduction… THIRD…We’ll talk about what makes good Conclusion… FOURTH…We’ll talk some ideas for constructing your Speaking Notes. OUTLINING & BODY Writing an Outline important for several reasons: (1) It saves time (2) It makes sure your ideas presented in logical order (3)
Premium Surfing
Zoee Gaige-Wilson Persuasive Speech Outline I. Introduction Animals can be ferocious and wild‚ but they can also be gentle and tame. Some are our pets‚ and some are powerful forces that are to be respected and admired. It is as easy to appreciate a loyal dog as it is to be in awe of a lion in its’ natural habitat. But the truth that many people either don’t know or don’t appreciate is that animals are essential to human existence and have played a vital role in improving the quality of our
Premium Animal testing Testing cosmetics on animals