1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
The movie that this book no doubt reminds me of is the Breakfast Club. In each there are five completely different characters who get paired up unknowingly. In the movie the characters meet in detention. In the book the characters are paired up during freshman orientation. Some of the characters even bear resemblance to characters in the movie. Whitney strongly reminds me of the pampered Claire‚ while Jake reminds me of the jock Andrew. Mia bears slight resemblance to the outcast Allison‚ and Gregor
Premium
healthier and better life. Eating healthy and exercising should be a part of every person’s day to day routine. Adapting to both can things can make a dramatic difference in how you look and feel. It can also prevent many things such as obesity‚ which is the most common thing that happens when you eat unhealthy every day and not getting enough exercise. The rate of obesity is getting higher each and every day. More people are becoming obese‚ and it seems like less people are eating healthy and working out
Premium Nutrition Obesity Physical exercise
1. According to Erikson According to the Erik Erikson‚ the "Breakfast Club"" adolescences are in the "Identity vs. Role Diffusion" Stage. During this period‚ teenagers seek to determine what is unique and distinctive about themselves. As they are in transition from childhood to adolescence‚ teens are trying to find themselves; "Who am I?" is the major question of the stage. Teens are trying to establish a sense of self‚ so they engage in a new type of behavior‚ roles or activities; they are very
Premium Adolescence Developmental psychology Identity
The 1985 film “The Breakfast Club” is a classic American coming-of-age-drama-comedy film. “The Breakfast Club” is written‚ produced‚ and directed by John Hughes‚ who was met with “resistance and skepticism” because he lacked filmmaking experience when he requested to direct this film. This film turned out to be Hughes’ directional debut. With a budget of one million dollars‚ this film grossed 51.5 million dollars worldwide. In just 97 minutes‚ we learn differences between “five strangers with nothing
Premium Family Bullying Abuse
John Hughes‚ the director of “The Breakfast Club‚” carefully depicted sociology dynamics throughout the classic film. Many people would agree that the film caught the extreme attention from various audiences due to its relatability using common sociological references. The director and writers of the film comically referenced and targeted specific sociological topics‚ such as cultures‚ educational values‚ family background‚ social statuses‚ and‚ of course‚ cliques. This film exemplified group
Premium Clique The Breakfast Club Culture
Unfortunately‚ this stereotype may never change. The Breakfast Club written and directed by John Hughes expresses exactly that theme. Fortunately‚ youth of every age understand exactly what they are going through and have the ability to change what is being thrust on them by the socialization process which begins in the home and is reinforced at school‚ not only by students and parents‚ but teachers like Mr. Vernon as well. In The Breakfast Club five unique personalities‚ each secure in his identity
Premium The Breakfast Club English-language films Sociology
Understand Child and Young Person Development Understand the expected pattern of development for children and young people from birth – 19 years Each child and young person will follow an expected pattern of development‚ focusing mainly the skills they are learning rather than the physical growth. Although when discussed the development of children it focuses on the skills it is undeniable that both skills and growth of children and young people are linked and will impact on the development on
Premium Child development Childhood Infant
The 1961 movie Breakfast at Tiffany’s directed by Blake Edwards and based on the novel of the same name‚ is about Holly Golightly a young woman who is living independently as a socialite in New York during the 60’s. The movie is regarded as a large reflection of American culture and the different values and opinions that were held by many people during the time. The movie is also a great example of filmmaking in the mid-20th century and how it compares to today’s style of filmmaking. The film‚ being
Premium Woman Marriage Family
There are many types of eating disorders. We are most familiar with the three major disorders Anorexia Nervosa‚ Bulimia Nervosa and Binge Eating Disorder. However‚ there are many minor disorders effecting millions of people like Prader–Willi Syndrome and Night Eating Syndrome. Anorexia Nervosa: A potentially dangerous and life threatening disease characterized by a person’s fear of gaining weight therefore resorting to self–starvation and excessive weight loss. Anorexia typical appears in girls
Premium Obesity Eating disorders Anorexia nervosa