during field-work. And‚also please keep onething in mind that we were sent to those villages‚where we can reach by easy transportation mode.But‚there are thousands of villages in India‚where even district administration and police cannot access in any extraordinary situations.Schools‚blackboards and other infrastuctural facilities are remote things for those villages. I appreciate your imagination for planning to adopt one BPL family by one tax-payer and Blackboard cleaner...but‚these poetic imagination
Premium City School Rural area
Command and Control - What Is It? Why Is It Important In The Public Services? Command and control is vital to the Uniformed Public Services and to the way they function and operate. If there were no command and control the Public Services would not have the ability to take control of situations in order for them not to get out of hand. It is important because it maintains order and helps the Public Services run smoothly and efficiently. If there is very little‚ poor or no command and control then
Premium Education Learning Teacher
FORM 5 Novels Step by wicked step Table of Contents Synopsis Elements Activities Assessment Answer Key Glossary Panel of writers STEP BY WICKED STEP NOVEL What is a novel? Only in a novel are all things given full play – D. H. Lawrence A novel is a long narrative in literary prose. Novels tell stories‚ which are typically defined as a series of events
Premium Stepfamily Family Ugly sisters
Chain of command is important in a police agency and a must have. Without the chain of command I do not believe the structure and integrity of the department would be as thick with good officers and high moral standards. The leadership is placed in a position due to their experience and ability to lead by example. Our chain of command in Knox County‚ starts with the sheriff and then is followed by a number of chiefs‚ captains‚ lieutenants‚ sergeants‚ corporals‚ patrolman‚ and correction officers
Premium Police Constable Crime
1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
How to solve a Rubik’s cube The purpose of this report is to inform the audience on how to solve a Rubik’s cube in three simple steps. Solving a Rubik’s cube can be difficult; however by solving one layer at a time‚ and knowing the correct algorithm to use for each desired move‚ makes solving a Rubik’s cube easier than it looks. Introduction Invented by mechanics in 1974. There are over 43 quintillion possible combinations for solving a Rubik’s cube. That is 43‚252‚003‚274‚489‚856‚000. (information-facts)
Premium Algorithm
contents of files diff diff file1 file2 Finds a string of text in a file grep grep this word or phrase thisfile.txt Formats a diskette mke2fs (or mformat /sbin/mke2fs /dev/fd0 (/dev/fd0 is the Linux equivalent of A:) Displays command help man man command Creates a directory mkdir mkdir directory View a file less less thisfile.txt Renames a file mv mv thisfile.txt thatfile.txt[e] Displays your location in the file system pwd pwd Changes directories with a specified path (absolute
Premium File system
Application Note 010 GSM AT Command Set Application Note AN010 GSM AT Command Set Technical specifications and claims may be subject to variation without prior notice. UbiNetics has endeavoured to ensure that the information in this document is correct and fairly stated‚ but does not accept liability for any error or omission. UbiNetics Ltd Cambridge Technology Centre Melbourn Herts SG8 6DP Tel: +44 (0) 1763 285 183 Prepared by: Date: Document Number: Chris Cockings 09-04-2001 BCO-00-0621-AN
Premium GSM
understood what has been asked of them. It would be a good idea to walk around the classroom to see if the children are doing the work correctly‚ making notes and to let the teacher know‚ then you can discuss this and give feedback if there has been any problems‚ then the teacher will be able to plan the next lesson and try to resolve these problems. The cycle of planning is - PLANNING‚ TEACHING‚ LEARNING AND ASSESSMENT‚ REVIEW When a teacher is planning her lessons it could be long term planning
Premium Term Time Lesson plan
STRENGTHENING COMMAND OF ENGLISH What ? WHY ? And HOW? BY ZAHAR IBRAHIM IPGM KDRI DEFINITION OF MBI/SOE ❖ SOE – To strengthen the command of English as the mandatory language to be learned‚ language of communication and language of knowledge at national and international level. Rational of soe …. Only 25% of the SC and MT teachers – proficient. - Only 53 – 58 % of teaching period use Eng. - 2007‚ Report by Trends in Mathematics Science Study(TIMSS)‚ 2003 – from 10th
Free Education School Teacher