Biology SL – Chapter 4 questions Page 57 1. a) Difference between protein and polypeptide: Proteins have a structure formed by one or more polypeptide chains whilst a polypeptide is a chain of amino acids. b) Fat and oil differences: They are both lipids‚ but fats are solid whilst oil are liquids. c) Difference between starch and glycogen: Starch is a polysaccharide found in plant tissue whilst glycogen has polysaccharide found in animals. d) Condensation and hydrolysis:
Premium Protein Amino acid Starch
(Lysine) and is encoded by EZH2‚ the EZH2 gene encodes part of the Polycomb group which make protein complexes that help to maintain genes transcriptional repressive state over successive cell generations. http://www.ncbi.nlm.nih.gov/gene/2146 Throughout this lab report template DNA that contains the gene EZH2 was provided‚ this will be amplified by a PCR and cloned into a vector. This Polycomb group proteins help maintain the cell identity during progress through chromatin
Premium DNA Gene Protein
Sequence ID/Fragment Code: 6649013 Answers: 1. Identify the gene from which the query sequence originates (Name of gene) - Homo sapiens interleukin 2 receptor‚ gamma (severe combined immunodeficiency (IL2RG)‚ mRNA - See Appendix 1 2. Provide the full protein sequence encoded by the gene. - >gi|4557882|ref|NP_000197.1| cytokine receptor common subunit gamma precursor [Homo sapiens] MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR
Free Protein DNA
think stop and start codon signals are necessary for protein synthesis? These are necessary because start codons tells the tRNA to begin translating the codons into proteins and stop codons tell the tRNA to stop translating codons into proteins. They are essential in the process of producing proteins. 6. Describe the processes of transcription and translation in your own words‚ based on what you have observed in the Gizmo. Transcription: Protein synthesis process starts in the nucleus where DNA
Premium DNA Amino acid Protein
membrane structure. Inside the bilayer hydrophobic portions of proteins and phospholipids because the inside of the bilayer is nonaqueous. the proteins bob in the fluid bilayer of phospholipids. The proteins also vary in structure and function. There are teh integral proteins; transmembrane proteins with hydrophobic regions that cover the hydrophobic interior of the plasma membrane. There is also the peripheral proteins‚ they are not embedded in the membrane‚ but they are attached
Premium Cell membrane Lipid bilayer Protein
translucent grease mark on a brown paper bag. The objective for the Dye test was to test for lipids. When mixed with water and the tested substance‚ a positive result will occur in it being separated from the water. The objective of the Protein Test was to test for proteins present in a substance using the Biuret Solution. The substance should produce a violet color within 10 drops of Biuret. The objectives of the Spit Lab were to test for starch‚ a reducing sugar‚ and effect of amylase on a cracker that
Premium Protein Glucose Fructose
A macromolecule can best be described as an immense molecule‚ made up of thousands of covalently bonded carbon atoms. There are four classifications of macromolecules: carbohydrates‚ lipids‚ proteins‚ and nucleic acids. Each classification performs specific functions that allow cells to grow and survive. Macromolecules can be either split or bonded through dehydration synthesis or hydrolysis. Dehydration synthesis occurs when water is released‚ electrons become shared‚ covalently bonding two
Premium DNA Protein RNA
Tissue Homogenates of Bos taurusMaterials and Methods The homogenates provided were made by homogenizing tissues in a sucrose phosphate buffer in a 1:20 ratio. The protein concentration in bovine cells was measured by diluting the homogenate with a 1:5 ratio; 50 microliters of homogenate and 200 microliters of water. Then 5 known protein concentration samples which were 0.4‚ 0.8‚ 1.2‚ 1.6‚ 2.0 mg/ml of bovine serum were used to determine absorbance with a spectrophotometer. Two additional samples
Premium Glycerol Glucose Liver
hydrophobic tails having any contact with the aqueous solution. Membranes contain phospholipids‚ proteins and carbohydrates‚ which are arranged in a fluid mosaic structure. The proteins within the membrane are responsible for most of the membranes’ properties. For example‚ on the inside surface of cell membranes‚ proteins are attached‚ involved in maintaining the cell’s shape. These could be enzymes too. Proteins on the outside surface of cell membranes can act as receptors‚ such as antigens or hormones
Premium Cell membrane Protein
failure. 1. What makes transcription important? 2. What is the purpose of proteins? 3. How would a substance that affects transcription make the liver to stop functioning? 4. Why did it take Caesar two days to die? Claudius Caesar’s Death 1. What makes transcription important? mRNA transfers the code for proteins from DNA in the nucleus to ribosomes in the cytoplasm 2. What is the purpose of proteins? Proteins build cells‚ cause change in other cells‚ make enzyme to control functions
Premium Protein Claudius Enzyme