that they contain carbon and hydrogen atoms (Gair‚ 2013). The four classes of biological molecules are carbohydrates‚ proteins‚ nucleic acids and
Premium Protein DNA Oxygen
Biology SL – Chapter 4 questions Page 57 1. a) Difference between protein and polypeptide: Proteins have a structure formed by one or more polypeptide chains whilst a polypeptide is a chain of amino acids. b) Fat and oil differences: They are both lipids‚ but fats are solid whilst oil are liquids. c) Difference between starch and glycogen: Starch is a polysaccharide found in plant tissue whilst glycogen has polysaccharide found in animals. d) Condensation and hydrolysis:
Premium Protein Amino acid Starch
consisting of a carbon bonded to three hydrogen atoms. The methyl group may be attached to a carbon or to a different atom. • Macromolecule: a giant molecule formed by the joining of smaller molecules‚ usually by a dehydration reaction. Polysaccharides‚ proteins‚ and nucleic acids are macromolecules. • Polymer: a long molecule consisting of many similar or identical monomers linked together by covalent bonds. • Monomer: the subunit that serves as the building block of a polymer. • Condensation (dehydration)
Free Protein DNA Amino acid
(Lysine) and is encoded by EZH2‚ the EZH2 gene encodes part of the Polycomb group which make protein complexes that help to maintain genes transcriptional repressive state over successive cell generations. http://www.ncbi.nlm.nih.gov/gene/2146 Throughout this lab report template DNA that contains the gene EZH2 was provided‚ this will be amplified by a PCR and cloned into a vector. This Polycomb group proteins help maintain the cell identity during progress through chromatin
Premium DNA Gene Protein
Sequence ID/Fragment Code: 6649013 Answers: 1. Identify the gene from which the query sequence originates (Name of gene) - Homo sapiens interleukin 2 receptor‚ gamma (severe combined immunodeficiency (IL2RG)‚ mRNA - See Appendix 1 2. Provide the full protein sequence encoded by the gene. - >gi|4557882|ref|NP_000197.1| cytokine receptor common subunit gamma precursor [Homo sapiens] MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR
Free Protein DNA
think stop and start codon signals are necessary for protein synthesis? These are necessary because start codons tells the tRNA to begin translating the codons into proteins and stop codons tell the tRNA to stop translating codons into proteins. They are essential in the process of producing proteins. 6. Describe the processes of transcription and translation in your own words‚ based on what you have observed in the Gizmo. Transcription: Protein synthesis process starts in the nucleus where DNA
Premium DNA Amino acid Protein
B I O L O G Y 130 INTRODUCTORY CELL BIOLOGY LECTURE NOTES Department of Biology University of Waterloo Fall‚ 2012 BIOL 130 LECTURE NOTES Fall‚ 2012 a Lecture Notes This booklet contains the notes that will be presented as part of the online modules. For copyright reasons‚ the figures that will be shown along with the notes cannot be reproduced. However‚ most of these figures come from the required course text‚ Cell and Molecular Biology: Concepts and Experiments‚ 6th edition
Premium Covalent bond Protein DNA
On researching new developments in the treatment of cystic fibrosis‚ I came across a very interesting article: “Ribosomal Stalk Protein Silencing Partially Corrects the ΔF508-CFTR Functional Expression Defect.” In the article‚ Viet et al1 reveal the potential application of the silencing of RPL12 (Ribosomal Protein L12)‚ to correct the ΔF508-CFTR biogenesis defect. As you know‚ cystic fibrosis is caused by a defect in the CF transmembrane conductance regulator (CFTR gene)‚ or more specifically‚ mutations
Premium DNA Gene Genetics
membrane structure. Inside the bilayer hydrophobic portions of proteins and phospholipids because the inside of the bilayer is nonaqueous. the proteins bob in the fluid bilayer of phospholipids. The proteins also vary in structure and function. There are teh integral proteins; transmembrane proteins with hydrophobic regions that cover the hydrophobic interior of the plasma membrane. There is also the peripheral proteins‚ they are not embedded in the membrane‚ but they are attached
Premium Cell membrane Lipid bilayer Protein
A macromolecule can best be described as an immense molecule‚ made up of thousands of covalently bonded carbon atoms. There are four classifications of macromolecules: carbohydrates‚ lipids‚ proteins‚ and nucleic acids. Each classification performs specific functions that allow cells to grow and survive. Macromolecules can be either split or bonded through dehydration synthesis or hydrolysis. Dehydration synthesis occurs when water is released‚ electrons become shared‚ covalently bonding two
Premium DNA Protein RNA