This report is presented as received by IDRC from project recipient(s). It has not been subjected to peer review or other review processes. This work is used with the permission of Do Nam Thang. © 2008‚ Do Nam Thang. Viet Nam’s rapid growth: at what environmental costs? By Do Nam Thang‚ PhD Viet Nam Environmental Protection Administration Ministry of Natural Resources and Government 67 – Nguyen Du – Ha Noi – Viet Nam Email: donamthang18@gmail.com Paper presented at the Conference on ‘Emergence
Free Environmentalism Pollution Air pollution
I am going to give a detailed analysis of a sequence from The Wrestler (2008) directed by Darren Aronofsky. The source I have decided to use for this analysis is the screenplay of the film‚ rather than a downloaded version of the script. The sequence I have chosen begins at 32min of the film and continues until 41:09 min. I chose this sequence because it is the most important sequence in the film‚ as it has a major influence on the events of the script that follow‚ and according to Syd Field’s Three
Premium Wrestling Fibonacci number
Sequence and Rate of Development What is meant by the sequence of development? Sequence of development means that the growth of a child takes place in a structured order with a series of changes or growth that leads to a matured state. The sequence of development depends on events that have previously happened. An example of this is that a baby will first start to roll and at around 6 – 7 months will try to sit up and soon after this they will start to crawl using their arms and legs.
Premium Infant Developmental psychology Childhood
1.) The only difference between the wild type and mutant sequence is a point mutation at gene 1755‚ where a guanine is replaced with an adenine. 2.) a.) Wild Type Protein Transcription: MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
Premium Gene DNA Amino acid
GROWTH OF A RAPID CYCLING BRASSICA Hypothesis: The purpose of this experiment is to demonstrate the totipotency of cells‚ and how this enables them to take on new functions when it is required for them to do so; In the case of this experiment‚ the cells of the Brassica plant will have to adapt to form roots and new stem material etc‚ in order to grow. I hypothesise that this will be exactly what happens and the plants will grow as they normally would under natural circumstances and conditions
Premium Stem cell Seed Plant
ZINN CHAPTER 1 - STUDY QUESTIONS 1. According to Zinn‚ what is his main purpose for writing A People’s History of the United States? 2. What is Zinn’s thesis for pages 1-11? 3. According to Zinn‚ how is Columbus portrayed in traditional history books? 4. Why does Zinn dispute Henry Kissinger’s statement: “History is the memory of states?” 5. What is Zinn’s basic criticism of historian Samuel Eliot Morison’s book‚ Christopher Columbus‚ Mariner? 6. What major issues does Bartolome
Free Christopher Columbus United States Indigenous peoples of the Americas
could change everything. However‚ from my point of view‚ technology has majorly changed our life. Food has always been the most import thing as same as water to human life. If food has changed‚ people would change too. From the film called “Food Sequence”‚ I can tell there was a big change that happened to what or how we eat over the decades. Besides‚ obesity‚ GMO and food safety have always been the subject that people and scientist
Premium Science Technology Engineering
Battleship Potemkin filmed in 1925. This film is about the uprising of the working class in the 1905 revolution‚ mainly the revolt on the Potemkin and the attack on the citizens of Odessa. One of the most powerful scenes in this film is the Odessa Steps Sequence. Eisenstein casted the people in this film based on their physical appearance‚ not their experience. He put out an advertisement looking for three types of people: Jewish Women‚ men who look good natured‚ and men who have squinty eyes and a rude
Premium Film editing Soviet Union
Fibonacci’s Rabbits The original problem that Fibonacci investigated (in the year 1202) was about how fast rabbits could breed in ideal circumstances. Suppose a newly-born pair of rabbits‚ one male‚ one female‚ are put in a field. Rabbits are able to mate at the age of one month so that at the end of its second month a female can produce another pair of rabbits. Suppose that our rabbits never dieand that the female always produces one new pair (one male‚ one female) every month from the second
Premium Fibonacci number Plant morphology Honey bee
Effects of Rapid Population Growth While population growth is at times a beneficial thing for a species‚ there are many factors that define when growth becomes detrimental. When population growth becomes "rapid" there is a great chance that the counter-productive level has been reached. The most accurate index is the balance between population and sustainability. 1. Rapid Growth o Rapid growth is a quick increase in population. The number concerned when calculating the population is the number
Free Population growth World population Demography