following suggested solutions and place them in the front of the room for easy access for students: a. Polysaccharide Solution - blended potato or lab grade starch solution b. Monosaccharide Solution – apple juice or lab grade glucose solution c. Protein Solution – blended meat or egg whites d. Lipid Solution – vegetable oil‚ melted butter 2. Set up 4 lab stations (twice around the room) for students to rotate. Each station should have the materials needed to conduct one of the following tests: a
Premium Protein Urinalysis Glucose
Determination of the presence of carbohydrates and protein in aqueous solution samples Objectives To determine the presence of starch‚ glycogen‚ reducing sugar‚ peptide‚ and proteins by utilizing Iodine test‚ Benedict test‚ and Biuret test. Introduction The purpose of this experiment was to identify the presence of macromolecules by using various positive and negative controls. The principle building blocks of living organisms are essentially constructed by carbon-containing
Free Glucose Protein Amino acid
appendages or LIMBS. COMPLIMENTARITY OF STRUCTURE AND FUNCTION - function always reflects structure. What a structure can do depends on its specific form. LEVELS OF THE HIERARCHY ATOMS - building blocks of matter. MOLECULES - water‚ sugar‚ proteins. GROUPS OF ATOMS. ORGANELLES - basic components of microscopic cells. CELLS - living structural and functional units of an organism. TISSUES - groups of similar cells having common structure and function. Four basic types. ORGAN
Free Protein DNA Cell membrane
that they contain carbon and hydrogen atoms (Gair‚ 2013). The four classes of biological molecules are carbohydrates‚ proteins‚ nucleic acids and
Premium Protein DNA Oxygen
Biology SL – Chapter 4 questions Page 57 1. a) Difference between protein and polypeptide: Proteins have a structure formed by one or more polypeptide chains whilst a polypeptide is a chain of amino acids. b) Fat and oil differences: They are both lipids‚ but fats are solid whilst oil are liquids. c) Difference between starch and glycogen: Starch is a polysaccharide found in plant tissue whilst glycogen has polysaccharide found in animals. d) Condensation and hydrolysis:
Premium Protein Amino acid Starch
consisting of a carbon bonded to three hydrogen atoms. The methyl group may be attached to a carbon or to a different atom. • Macromolecule: a giant molecule formed by the joining of smaller molecules‚ usually by a dehydration reaction. Polysaccharides‚ proteins‚ and nucleic acids are macromolecules. • Polymer: a long molecule consisting of many similar or identical monomers linked together by covalent bonds. • Monomer: the subunit that serves as the building block of a polymer. • Condensation (dehydration)
Free Protein DNA Amino acid
(Lysine) and is encoded by EZH2‚ the EZH2 gene encodes part of the Polycomb group which make protein complexes that help to maintain genes transcriptional repressive state over successive cell generations. http://www.ncbi.nlm.nih.gov/gene/2146 Throughout this lab report template DNA that contains the gene EZH2 was provided‚ this will be amplified by a PCR and cloned into a vector. This Polycomb group proteins help maintain the cell identity during progress through chromatin
Premium DNA Gene Protein
Sequence ID/Fragment Code: 6649013 Answers: 1. Identify the gene from which the query sequence originates (Name of gene) - Homo sapiens interleukin 2 receptor‚ gamma (severe combined immunodeficiency (IL2RG)‚ mRNA - See Appendix 1 2. Provide the full protein sequence encoded by the gene. - >gi|4557882|ref|NP_000197.1| cytokine receptor common subunit gamma precursor [Homo sapiens] MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR
Free Protein DNA
think stop and start codon signals are necessary for protein synthesis? These are necessary because start codons tells the tRNA to begin translating the codons into proteins and stop codons tell the tRNA to stop translating codons into proteins. They are essential in the process of producing proteins. 6. Describe the processes of transcription and translation in your own words‚ based on what you have observed in the Gizmo. Transcription: Protein synthesis process starts in the nucleus where DNA
Premium DNA Amino acid Protein
B I O L O G Y 130 INTRODUCTORY CELL BIOLOGY LECTURE NOTES Department of Biology University of Waterloo Fall‚ 2012 BIOL 130 LECTURE NOTES Fall‚ 2012 a Lecture Notes This booklet contains the notes that will be presented as part of the online modules. For copyright reasons‚ the figures that will be shown along with the notes cannot be reproduced. However‚ most of these figures come from the required course text‚ Cell and Molecular Biology: Concepts and Experiments‚ 6th edition
Premium Covalent bond Protein DNA