"Homo sapiens sapiens" Essays and Research Papers

Sort By:
Satisfactory Essays
Good Essays
Better Essays
Powerful Essays
Best Essays
Page 33 of 50 - About 500 Essays
  • Powerful Essays

    Tracing Overpopulation Through the Historiographical Methods of Dr. Paul Ehrlich from the 1960’s to the 1990’s Tracing Overpopulation Through the Historiographical Methods of Dr. Paul Ehrlich from the 1960’s to the 1990’s While driving through the overpopulated streets of Delhi‚ India‚ Paul Ehrlich noticed just how many people were in the world. It took his family a couple of hours just to travel a short distance through the city. Take into consideration

    Premium World population Population Population growth

    • 2593 Words
    • 11 Pages
    Powerful Essays
  • Good Essays

    Racial prejudice is an insidious moral and social disease affecting peoples and populations all over the world. It is diagnosed by the cataloguing of its various symptoms and manifestations which include fear‚ intolerance‚ separation‚ segregation‚ discrimination‚ and hatred. While all of these symptoms of racial prejudice may be manifest‚ the single underlying cause of racial prejudice is ignorance. Historically‚ a race of people is defined as a population with distinguishable biological features

    Premium Race Discrimination Racism

    • 472 Words
    • 2 Pages
    Good Essays
  • Good Essays

    Crossflatts Primary School Morton Lane Crossflatts Bingley West Yorkshire BD16 2EP Tel: 01274 782070 louarmour@hotmail.com 26 August 2011 Dear Reader‚ Re: Darwin‚ Evolution and the Origins of Life I wrote this plan (see below) as a Topic for our Yr5/6. Time constraints meant I couldn’t cover everything I wanted to cover during ‘Topic’. Other investigations that may have been included are: Artificial Selection Why are cows and sheep not extinct? Why are there so many kinds of

    Free Evolution Natural selection Human evolution

    • 7720 Words
    • 30 Pages
    Good Essays
  • Good Essays

    Epipalaeolithic

    • 583 Words
    • 3 Pages

    nature‚ these have not been preserved to any great degree. Surviving artifacts of the Paleolithic era are known as Paleoliths. Humankind gradually evolved from early members of the genus Homo such as Homo habilis — who used simple stone tools — into fully behaviorally and anatomically modern humans (Homo sapiens sapiens) during the Paleolithic era. The Neolithic Age‚ Era‚ or Period‚ or New Stone Age‚ was a period in the development of human technology‚ beginning about 9500 B.C.E. in the Middle East

    Premium Paleolithic Stone Age Human

    • 583 Words
    • 3 Pages
    Good Essays
  • Satisfactory Essays

    Gene Report 3

    • 488 Words
    • 4 Pages

    Sequence ID/Fragment Code: 6649013 Answers: 1. Identify the gene from which the query sequence originates (Name of gene) - Homo sapiens interleukin 2 receptor‚ gamma (severe combined immunodeficiency (IL2RG)‚ mRNA - See Appendix 1 2. Provide the full protein sequence encoded by the gene. - >gi|4557882|ref|NP_000197.1| cytokine receptor common subunit gamma precursor [Homo sapiens] MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR

    Free Protein DNA

    • 488 Words
    • 4 Pages
    Satisfactory Essays
  • Good Essays

    Hominid Evolution

    • 2424 Words
    • 10 Pages

    Hominid Evolution The evolution of hominids has been and still is a heated topic of debate. Many scientists debate over which species can be classified as “human”. The root "hominid" refers to members of the family of humans‚ Hominidae‚ which consists of all species on our side of the last common ancestor of humans and living apes. The time split between humans and living apes used to be thought of fifteen to twenty millions of years ago‚ but now the time period has shifted to around five

    Premium Human evolution Human Neanderthal

    • 2424 Words
    • 10 Pages
    Good Essays
  • Good Essays

    of necessity implies that the origin of most creative ways of making life easy began as supported by realization that man needed them to survive in the changing life experiences. Firstly‚ the prehistoric era events included the emergence of Homo sapiens sapiens‚ the man with an enhanced brain activity able to support different high-level primate intelligence chores such as tool making‚ cultivation of crops‚ and domestication of animals. In summary‚ civilization of Europe and Asia contribute the major

    Premium

    • 333 Words
    • 2 Pages
    Good Essays
  • Good Essays

    Journal of Physiological Anthropology. 118‚231 -238. Essay on The Evolution Of Bipedal Locomotion Subject: Evolution of Bipedal Locomotion What are we? To the biologist we are members of a sub-species called Homo sapiens sapiens‚ which represents a division of the species known as Homo sapiens. The most interesting aspect about our species is that we are able to and can walk upright on our hind legs at all times. This is defiantly not the usual way of getting around for a mammal. The view of evolution

    Premium Human Primate Human evolution

    • 932 Words
    • 3 Pages
    Good Essays
  • Good Essays

    now created the world Utopia. Steve Jones of University College London said “Utopia if you want to know what Utopia is‚ just look around you.”(Jones 2002). In today’s society almost everyone has the opportunity of equal chance to having children. Homo sapiens is one of the largest living species in the world and we can change or help the way we live easier. Stephen Hawkings is a British theoretical physicist‚ cosmologist‚ and author. He created a theory called Self Designed Evolution‚ it is a new

    Premium Human Natural selection Stephen Hawking

    • 477 Words
    • 2 Pages
    Good Essays
  • Better Essays

    Genographic Project

    • 986 Words
    • 4 Pages

    the Earth in today ’s modern time‚ are theorized to all be genetically linked to a single African female‚ believed to have lived 60‚000 years ago. This extraordinary finding has inspired a global project to unveil the migration journey of the homo sapien (Man). The project‚ led by the National Geographic society‚ IBM‚ geneticist Specer Wells‚ and the Waitt Family Foundation have worked at mapping the origins of Man‚ and his global journey through time‚ of his arrival into modern society. This

    Premium Human Genetics

    • 986 Words
    • 4 Pages
    Better Essays
Page 1 30 31 32 33 34 35 36 37 50